PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000276765
Common NameNAC4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 350aa    MW: 39820.4 Da    PI: 6.7723
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000276765genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.73.8e-56161411128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrFhPtdeel+++yL++kv ++ + + ++i evd++k+ePwdLp ++k +e+ewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++  
  MDP0000276765  16 LPPGFRFHPTDEELISHYLCPKVLDNFFCA-KAIGEVDLNKCEPWDLPWRAKMGEREWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYK-A 109
                    79************************9888.89***************888999****************************************.9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++lvg+kktLvfykgrapkg+kt+Wvmheyrl
  MDP0000276765 110 KTLVGMKKTLVFYKGRAPKGVKTNWVMHEYRL 141
                    99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6412166IPR003441NAC domain
PROSITE profilePS5100559.47716166IPR003441NAC domain
PfamPF023656.9E-3017141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MENXSGFINV DEQMELPPGF RFHPTDEELI SHYLCPKVLD NFFCAKAIGE VDLNKCEPWD  60
LPWRAKMGER EWYFFCVRDR KYPTGLRTNR ATEAGYWKAT GKDKEIYKAK TLVGMKKTLV  120
FYKGRAPKGV KTNWVMHEYR LDGKNSACNL PQTAKNEWVI CRIFQKSSGG KKIHISGLVR  180
PSPFVNELRS SLLPPLMDSP PYNSDARTTP TACETSHVSC FSDPPEDXKT QDDIMDSFNN  240
SNNHHNNDIP YACSSPSNPS AHLNSIYSNQ ITPNIGLLQH QNSVLMQDQS FMRMLIENQA  300
PNLRRSAKIE FSQDAGLSID ASSVVSNREM VQDDPSYSSA PVEFDCLWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-561317214171NAC domain-containing protein 19
4dul_A1e-561317214171NAC domain-containing protein 19
1ut7_B1e-561317214171NO APICAL MERISTEM PROTEIN
1ut7_A1e-561317214171NO APICAL MERISTEM PROTEIN
1ut4_B1e-561317214171NO APICAL MERISTEM PROTEIN
1ut4_A1e-561317214171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.128910.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1774230.0FJ177423.1 Malus x domestica NAC domain protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008379376.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-131NC100_ARATH; NAC domain-containing protein 100
TrEMBLB6DXL40.0B6DXL4_MALDO; NAC domain class transcription factor
STRINGVIT_14s0108g01070.t011e-155(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-124NAC domain containing protein 100
Publications ? help Back to Top
  1. Varkonyi-Gasic E,Gould N,Sandanayaka M,Sutherland P,MacDiarmid RM
    Characterisation of microRNAs from apple (Malus domestica 'Royal Gala') vascular tissue and phloem sap.
    BMC Plant Biol., 2010. 10: p. 159
    [PMID:20682080]